SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8ZLA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A8ZLA4
Domain Number - Region: 72-91
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.0177
Family Intron-encoded homing endonucleases 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A8ZLA4
Sequence length 125
Comment (tr|A8ZLA4|A8ZLA4_ACAM1) Uncharacterized protein {ECO:0000313|EMBL:ABW31931.1} KW=Complete proteome; Reference proteome OX=329726 OS=Acaryochloris marina (strain MBIC 11017). GN=AM1_B0211 OC=Acaryochloris.
Sequence
MPMIRARYPDNWDEIATRVKDAANWRCTQCGKPCRKPGVEWLHFAFWLMITHPEWFPMTS
EGEEEKPQRFTLTVAHLDQDPQNNHPDNLKALCAPCHLRFDAPFRKANAYTKQEWFGQVK
LEDLS
Download sequence
Identical sequences A8ZLA4
gi|158340075|ref|YP_001521245.1|NC_009927 329726.AM1_B0211 gi|158340075|ref|YP_001521245.1| WP_012167081.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]