SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8ZRM5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A8ZRM5
Domain Number - Region: 107-208
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.045
Family D-glucarate dehydratase-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8ZRM5
Sequence length 250
Comment (tr|A8ZRM5|A8ZRM5_DEIGD) Uncharacterized protein {ECO:0000313|EMBL:ABW35134.1} KW=Complete proteome; Reference proteome OX=319795 OS=Deinococcus geothermalis (strain DSM 11300). GN=Dgeo_3094 OC=Deinococcaceae; Deinococcus.
Sequence
MTRRDLQRVTAKLQPDQVSQVLDTVTVLQTRRLARKVITVRLIGQGELLLDGVRVDLHSH
TARAAVLLNQLHVQPELSTAQIAETVFDQDLTPMPSDEARKVKTQVSALVLKLRKAFGEA
VILRTGPQNSSTYQLGRALYQVVVDLDQLEEDLRAGPERLPHVAHALRSGILTGESLVWA
TDRRDQVFGHFREALMEAVQRCGSEVQLAGLAKSIALFSATEGVLAEEVHPLFAALALAR
ARLGMPVLKQ
Download sequence
Identical sequences A8ZRM5
319795.Dgeo_3094 gi|158421605|ref|YP_001527832.1|NC_009939 WP_012173254.1.71355 gi|158421605|ref|YP_001527832.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]