SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9A1H7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9A1H7
Domain Number 1 Region: 3-452
Classification Level Classification E-value
Superfamily L-aspartase-like 2.67e-120
Family L-aspartase/fumarase 0.00000000655
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A9A1H7
Sequence length 453
Comment (tr|A9A1H7|A9A1H7_NITMS) Fumarate lyase {ECO:0000313|EMBL:ABX13156.1} KW=Complete proteome; Reference proteome OX=436308 OS=Nitrosopumilus maritimus (strain SCM1). GN=Nmar_1260 OC=Nitrosopumilus.
Sequence
MKFRLDQDSLGKVKIPSDAYYGAFTGRAIKQYHVTGNTSHENLIKSFVMIKRSAAVANMK
TKAIDTKRGKAIVSACDKILAGKHVDQFVVDMINSGAGTAFNMNSNEVISNVALEILRKK
KGQYEFLHPNDHVNMSQSSNDTYPTAMHVAILMNLKETIPAIDILIKSLSKKAKQFSSFK
KIGRTHLMDALPVTLGSEFAAYVTSITKARNELVASQKELQNVALGGTAVGSGANTPKGY
RKIAIAELGKISKLPLRPEKDMQHGLQSKYAVANCSGALRNLALEIGKLANDIRLMASGP
IAGLAEIGIPAVHAGSSIMPGKVNPSLAECMNMICFNIIGNDTAVSYAAQGGQFELNVML
PGMLKCMLESTDMIKNFLPIFSANLIDGLTANKDKLRADIENSPVIVTLLTPKIGYLKSA
ELFKESLKTGKTIRELVVSKKLMTNKEIDSLFG
Download sequence
Identical sequences A9A1H7
gi|161528768|ref|YP_001582594.1| 436308.Nmar_1260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]