SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9A342 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9A342
Domain Number 1 Region: 101-170
Classification Level Classification E-value
Superfamily Single hybrid motif 3.8e-19
Family Biotinyl/lipoyl-carrier proteins and domains 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A9A342
Sequence length 170
Comment (tr|A9A342|A9A342_NITMS) Biotin/lipoyl attachment domain-containing protein {ECO:0000313|EMBL:ABX12170.1} KW=Complete proteome; Reference proteome OX=436308 OS=Nitrosopumilus maritimus (strain SCM1). GN=Nmar_0274 OC=Nitrosopumilus.
Sequence
MDYKIADVEKSFEGKITENLGNNDYVIKINDKEHQLKILSMNAKGIEFILDQQYHKAKYL
ETATNEMNLVIDNVPVTLNMNTHFDEIVYKNSGGGGAGGAQVALKSQIPGKVVSIAVAEG
DSVKKGDVVCTLESMKMQVGIKAHKDGEVKNLKIKEGATVAKGDVIADLE
Download sequence
Identical sequences A9A342
436308.Nmar_0274 gi|161527782|ref|YP_001581608.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]