SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9A764 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9A764
Domain Number 1 Region: 7-241
Classification Level Classification E-value
Superfamily SAICAR synthase-like 9.48e-75
Family SAICAR synthase 0.00000621
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A9A764
Sequence length 245
Comment (tr|A9A764|A9A764_METM6) SAICAR synthetase {ECO:0000256|HAMAP-Rule:MF_00137} KW=Complete proteome OX=444158 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332). GN=MmarC6_0352 OC=Methanococcaceae; Methanococcus.
Sequence
MLYDISKITAKEPIYVGKAKSIYTIEENEKEVLVEFRDDITAGNGAKHDVKFGKGYLNTV
ISNELFKVLEKNNVPTHLIEYIEPNHMIAKNVKIIPLEVIVRNIAAGSLCKKYPFEQGQV
LKTAVTQLDYKNDDYGDPMLNNEIAIELGLATEEELVEIKKLALKVNDVLKGFFDEKGII
LVDFKIEVGKTVDGDIVVADEISPDTMRLWDKETKDVLDKDVFRKDLGDVLEKYKIVAER
IGCLK
Download sequence
Identical sequences A9A764
WP_012193148.1.31524 444158.MmarC6_0352 gi|159904743|ref|YP_001548405.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]