SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9A7R1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9A7R1
Domain Number 1 Region: 2-192
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.71e-38
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A9A7R1
Sequence length 202
Comment (tr|A9A7R1|A9A7R1_METM6) Pyruvate ferredoxin/flavodoxin oxidoreductase {ECO:0000313|EMBL:ABX01453.1} KW=Complete proteome OX=444158 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332). GN=MmarC6_0636 OC=Methanococcaceae; Methanococcus.
Sequence
MNFSVIICGVGGQGVVLASRLLAITAMNSGFHVNTAETLGMSQREGSVVSHLQFGENIRS
SLIPEGSADLIIGLEVSEVARNLHFLKKNGKIITNSKMILPSAKSSNEKYDSEKIINFIK
EKVKSTICIDFSEIAKVAGNPKSMNVSVLSAAFYTGFLPLKYDDFLKTIESEIPEKYQNI
NLNAAKLSAETISNILEGHDEQ
Download sequence
Identical sequences A9A7R1
WP_012193353.1.31524 gi|159905023|ref|YP_001548685.1| 444158.MmarC6_0636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]