SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9A8M3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9A8M3
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily GlnB-like 2.16e-40
Family Prokaryotic signal transducing protein 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A9A8M3
Sequence length 112
Comment (tr|A9A8M3|A9A8M3_METM6) Nitrogen regulatory protein P-II {ECO:0000313|EMBL:ABX01696.1} KW=Complete proteome OX=444158 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332). GN=MmarC6_0881 OC=Methanococcaceae; Methanococcus.
Sequence
MKKLEAIIRMERLGLVKNALYKSGCVSLTVTDVKGRGIQGGVVEKYRGTEHVVEILPKVK
LELVINEKDVDSVVKIIAENAYTGKPGDGKIFVIPVEDVYRVRTGERGSKAI
Download sequence
Identical sequences A9A8M3
gi|159905266|ref|YP_001548928.1| 444158.MmarC6_0881 WP_012193650.1.31524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]