SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9AAE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9AAE8
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily GlnB-like 4.08e-27
Family Divalent ion tolerance proteins CutA (CutA1) 0.0000803
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A9AAE8
Sequence length 104
Comment (tr|A9AAE8|A9AAE8_METM6) CutA1 divalent ion tolerance protein {ECO:0000313|EMBL:ABX02321.1} KW=Complete proteome OX=444158 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332). GN=MmarC6_1508 OC=Methanococcaceae; Methanococcus.
Sequence
MGKPTLVYTTFPSLENAKSIVGYLLEKKMIACANLREHESHYLEDNDIVIKTEVGAFLKT
VENRWDILKDMINEIHPLETPVILKINIDDSNEEFENWICNITK
Download sequence
Identical sequences A9AAE8
WP_012194241.1.31524 444158.MmarC6_1508 gi|159905891|ref|YP_001549553.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]