SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9AWL2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9AWL2
Domain Number 1 Region: 8-392
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 7.46e-130
Family ArgJ-like 0.000000854
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A9AWL2
Sequence length 395
Comment (tr|A9AWL2|A9AWL2_HERA2) Arginine biosynthesis bifunctional protein ArgJ beta chain {ECO:0000256|HAMAP-Rule:MF_01106} KW=Complete proteome; Reference proteome OX=316274 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785). GN=Haur_4139 OC=Herpetosiphonaceae; Herpetosiphon.
Sequence
MSIFRFAAGFRSAAGRCGLKASGNPDLSLLVADNVCTGAGVFTTSLVKAAPVLYDQAVLA
EHASEIRAIIANAGCANACTGAQGDAAAREMARLAAEAVGCEPHQVLVLSTGVIGHQLNV
EKVAKGVAAIAPELGVEHAPALSEAIMTTDTRPKTSSATAVIDGVEVTVAGVAKGAGMIH
PMMATMLSIVTTDAAIDADLAQSLLREVTDASFNCVTVDGDPSTNDTLLLLASGVSGVTI
NASNIAAFRQALEIVCIDLAKQIAADGEGATKLITITVDHAPSVAAARTVARKIACSPLV
KTAIHGGDPNWGRILAAAGVAGVPFDPSHVELWLGEVQLVAGGTPTNYNEREAASQIGGQ
QVAIRLNLGAGAATGYAWTCDFSAEYVRINADYRT
Download sequence
Identical sequences A9AWL2
316274.Haur_4139 gi|159900652|ref|YP_001546899.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]