SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9AYT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9AYT3
Domain Number 1 Region: 405-511
Classification Level Classification E-value
Superfamily SpoIIaa-like 6.47e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0064
Further Details:      
 
Domain Number 2 Region: 304-353
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000458
Family HAMP domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A9AYT3
Sequence length 523
Comment (tr|A9AYT3|A9AYT3_HERA2) Anti-sigma-factor antagonist {ECO:0000313|EMBL:ABX05061.1} KW=Complete proteome; Reference proteome OX=316274 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785). GN=Haur_2421 OC=Herpetosiphonaceae; Herpetosiphon.
Sequence
MRARVRRRVTWIITLSALLPLLSVWILVLYISYRAEEQSAERQQVALTDLAAEDFRRFLF
NTTIELQDVAENIARETDPQTITAQQLSTLGLFRSSFAEVAIYSADGQRQVASSRFGDPT
LPMSLTGAQLLADLSTRRVSFADPPSFTGTISRKLAPQEIPRFRVATQLLSSNNQALFLV
ADVSMQRIWTSTTRIETAAEMRVLILTEQGDLISAAKIESLLEHPEMRGIPLLGSEATVA
TYESVFGEEVLGVRTSIEPVDWILVVERPLEVIYGNVGRLAVSLLMIIFIATPIVIGVGW
YVGRRIAGPIQTLYAGVTRFSENPNNFEPVLLDTRDELASLAGAFNTMASGLNASQKRLA
NLNEELEAQVVGRTSELHNALAEVQAQNLAQERLLDTVRRLSMPSIPITKHMVVMPLVGE
FSADRANDISTTLLLTIEQERAKIVILDITGVPVVDNIVARAILDAAQAARLLGAQVILA
GIRPDMAETLVNLHINLGMIESAATLEQAFKRGMEYLRVNRLS
Download sequence
Identical sequences A9AYT3
316274.Haur_2421 gi|159898942|ref|YP_001545189.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]