SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9B623 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9B623
Domain Number 1 Region: 3-177,917-1010
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.8e-22
Family ABC transporter ATPase domain-like 0.0092
Further Details:      
 
Domain Number 2 Region: 466-559
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.00000000347
Family Rad50 coiled-coil Zn hook 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A9B623
Sequence length 1023
Comment (tr|A9B623|A9B623_HERA2) SMC domain protein {ECO:0000313|EMBL:ABX05816.1} KW=Complete proteome; Reference proteome OX=316274 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785). GN=Haur_3179 OC=Herpetosiphonaceae; Herpetosiphon.
Sequence
MLPEKLRVRNFMCYRDDVPTLDFEGIRVACLSGENGAGKSALLDAITWALWGKARVSSDD
ELIALGAQEMEVDLQFSVAKTSYRVLRRRSSAKRGQTILEIQVNDGDNWRAISGNSIRET
QEIIHSVLRMEYDTFINSAFLVQGKADEFTRKAPAERKRVLAEILGLDAYEQLEARAKEQ
VRYFSDRAQGLEGTISSYREWVNKRDFYLSQEAEAQQRVQQLSHEIERATVVFEQADQQR
RALEHRKAERDRELSRSRDLERQIAESDGDYRQLAQDIGVAQAMVARQSEIETNFQVLQA
AREELVVLDRLREQIVQLNDQYKEQRALVEREELSLQHQLQQYQRDQQTNAELIANKASK
QADLAALAEQLAGFADDQRHLEQARSQRNELEQQSTNLTQLQVEVQRLQGLINVRGDSLI
AAREEQNRRIIEADNVLANESRWRSEFETSVAQQKALIRDERKLQEMRSRDQQDAKQLGE
LSAQESNLKQLGKQINDKIDQLRATHDTHCPLCQSDIGQHGIHQVIEQYIVERDDLRDQY
REASQARKQLSNEYDARQREIQGLERKVAQLSTLAAAVGRLEGQISEAQEHRSKRSEAES
TLRDLNQRLEHGDFAHEERAALAQAQTEIAELGLDQAALDAQRQANGRLIAQLEQRLAQR
GTIEAKAAVLQEQLERIQAAETHNATLHETILSLQVQIDSQQFAQTARQQAEAIYQQMAE
LGYASQRHQEVRDAVASLGHWEGEYHQLRSAQTNLATNQRQAQRLAELIERQRQDLAQIQ
VMLNQLNQELAQLPAAIQAAETAQRTINEFRGRLAVAQKDLGAAQQNVQHVAQVAEQLAA
AEKELLSVQDQRDVHSELVRAFGKKGIQAMLIETAIPELEREANELLSRMTDNQMHLRFE
TQRETKKGDTSETLDIQIADEQGTRRYDLYSGGEAFRINFAIRIAMSKMLARRAGANLQT
LIIDEGFGSQDGRGRERLVEAITQVQPDFSRILVITHIQELKDQFPVQIEITKHDNGSRW
AVN
Download sequence
Identical sequences A9B623
gi|159899697|ref|YP_001545944.1| 316274.Haur_3179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]