SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9F627 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9F627
Domain Number 1 Region: 306-473
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 1.44e-18
Family Nitrous oxide reductase, N-terminal domain 0.029
Further Details:      
 
Domain Number 2 Region: 132-362
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0000000000000392
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.044
Further Details:      
 
Weak hits

Sequence:  A9F627
Domain Number - Region: 5-32
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0867
Family DNA primase zinc finger 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A9F627
Sequence length 474
Comment (tr|A9F627|A9F627_SORC5) Uncharacterized protein {ECO:0000313|EMBL:CAN97859.1} KW=Complete proteome; Reference proteome OX=448385 OS=So ce56)). GN=sce7690 OC=Sorangiineae; Polyangiaceae; Sorangium.
Sequence
MSERRVPCPRCGARIVEGARKCRACKGWLGERHRGSVGSLSGREPRLARAAVTVASGVAA
VIIATLTSLKSPVGEAPPLTALAPEGAASRAARDTADDAPDPAAFGPDAAEPAPPPAEPK
GPWRAREFRIGDVHPLDVVFNPSGASIYVSADDASLREYKLQSGELIHKASMPAQGDHIR
LLFDRYVAVLRHQDAARIPVMDTTAWDRDPVLLDVGRTPGDIVALPDGRTVVAATTDTKR
VTKFELPTGVRLANITLPHATGQLFLVQAEGRPYIAALGALTHAGRPAGAWIDLFDPSES
PFGATRRSIAVGREPREGDITRDGGAVFFPDRLSNTAILLSVAGVTETRKTPVGVGPTAG
FLLDEDRYGITLNAEARTASVIDLSTMQVKSTLPLRGVPLTGVTSPDRKTLFVALGGTQW
PPVGSGVAVIAGDPPRVVASLPTGKGACAVAVSKDGARAVVASYWDRSITVLER
Download sequence
Identical sequences A9F627
448385.sce7690 WP_012240298.1.90317 gi|162455972|ref|YP_001618339.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]