SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9G6L2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9G6L2
Domain Number 1 Region: 5-107
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 6.98e-24
Family Frataxin-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A9G6L2
Sequence length 112
Comment (tr|A9G6L2|A9G6L2_SORC5) Iron-sulfur cluster assembly protein CyaY {ECO:0000256|HAMAP-Rule:MF_00142, ECO:0000256|SAAS:SAAS01015787} KW=Complete proteome; Reference proteome OX=448385 OS=So ce56)). GN=sce2549 OC=Sorangiineae; Polyangiaceae; Sorangium.
Sequence
MSGEPLSEREFDDVADRSLRALDRAINEIPDGVEADLQSGILTLEFEDGIKYVVNSHRAA
RQIWMAAERAAWHFDYRPSEDRWVAQKSGEELWSTLEAVLSRKLGRAVKLAR
Download sequence
Identical sequences A9G6L2
448385.sce2549 gi|162450821|ref|YP_001613188.1| WP_012235181.1.90317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]