SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9GIA7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9GIA7
Domain Number 1 Region: 93-363
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.93e-61
Family L-arabinose binding protein-like 0.0000258
Further Details:      
 
Domain Number 2 Region: 36-92
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.39e-17
Family GalR/LacI-like bacterial regulator 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A9GIA7
Sequence length 386
Comment (tr|A9GIA7|A9GIA7_SORC5) Lactose operon repressor {ECO:0000313|EMBL:CAN93240.1} KW=Complete proteome; Reference proteome OX=448385 OS=So ce56)). GN=sce3081 OC=Sorangiineae; Polyangiaceae; Sorangium.
Sequence
MDVDTISPRARLSLAPMDDNSPPEGRIKRGGRRAAVMVDVAKLAGVSYQTVSRVLHDSPH
VHRDTRERVLDAIRQLDYRPSSVAQALVTGRSRTLGVVSFDTTHYGPASTLHGLETAAHD
AGYGVSVVSLKSLSRAPVVDAVKGLCDQGADGIMVIAPLRSAVDALRHVSSDVPVVAVEG
GPDDSVPVVAVDQHGGATAATRHLLDLGHRAVWHIAGSTDSLEAEQRIDGWRSTLEAAGV
EPPPLLRGDWSARSGYELAPQLARTPGATAVFVANDQMALGVLRYLHEIGRAVPRDISIV
GFDDIPEAAYFTPPLTTVRQDFAELGRRCLHVLLGQIESGRRSCSRVVVEAELVLRKSTA
AVPGTDERSSLPAASARIPSRIRNPS
Download sequence
Identical sequences A9GIA7
448385.sce3081 gi|162451353|ref|YP_001613720.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]