SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9IMM6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9IMM6
Domain Number 1 Region: 6-134
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.08e-38
Family FUR-like 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A9IMM6
Sequence length 137
Comment (tr|A9IMM6|A9IMM6_BART1) Ferric uptake regulation protein {ECO:0000256|RuleBase:RU364037} KW=Complete proteome OX=382640 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506). GN=BT_0216 OC=Bartonellaceae; Bartonella.
Sequence
MNKKRNYEQELRAAGLRVTRQRRVILDILADTNDHPNAFEIFQRANKIDSSISLSTVYRT
MKKLEVNGTIHRHTFSGGPSRFEQADGQHHDHLIDIETGQVIEFHSDVIEKLQEEIAKSL
GYNIVHHRLELYGKKNS
Download sequence
Identical sequences A9IMM6
gi|163867492|ref|YP_001608691.1| 382640.Btr_0216 WP_012230608.1.76171 WP_012230608.1.90605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]