SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9RRE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9RRE4
Domain Number 1 Region: 142-178
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000117
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A9RRE4
Sequence length 218
Comment (tr|A9RRE4|A9RRE4_PHYPA) Predicted protein {ECO:0000313|EMBL:EDQ78515.1} KW=Complete proteome; Reference proteome OX=3218 OS=Physcomitrella patens subsp. patens (Moss). GN=PHYPADRAFT_69491 OC=Physcomitrella.
Sequence
MFVKEAQSATIAASLERVKVWEECHYDQHLTVGTTMIPSQGGYQMINWNDASKSYPGRSD
YGTIPQGIVNAVPLQAVLPSSSQPYVPYSAYQKSIPTKELTNELVSRDPNESLLLTLTKK
IDELAVNLPKDKEKRHKPINMRPNVWCSNCKGQGHLVTECSSPPQMMVLCIFCGDANKPA
GGGQRSCSTGLTSTLRRGGERSAYQGPIKRQESNSGSG
Download sequence
Identical sequences A9RRE4
jgi|Phypa1_1|69491|fgenesh1_pg.scaffold_23000093 XP_001756561.1.60028 3218.JGI69491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]