SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9RTC3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A9RTC3
Domain Number - Region: 197-236
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0157
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A9RTC3
Sequence length 648
Comment (tr|A9RTC3|A9RTC3_PHYPA) Predicted protein {ECO:0000313|EMBL:EDQ77892.1} KW=Complete proteome; Reference proteome OX=3218 OS=Physcomitrella patens subsp. patens (Moss). GN=PHYPADRAFT_70290 OC=Physcomitrella.
Sequence
MVELFGLAAIPEIRDHITSITDHYGNSWEVFLHTLKDEYFLEDTNHVTKLFLEWIERPNK
NLQYSQLSKGEKLTLERNKVDLFLQAAHGELQRKLELLLEDKEEDEGLIIKWKNVEDAMG
LLTKRERSKDRSNILKIVQAPKAPVCTTPPTMPIVQPSTSLSKKVDIEMEEIKQGMRDFQ
IKLARLEENTSTKNLKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRKGIICWKDGKIA
LKDREDLLQTNFGKGGMRAFVQDYLKEHEIAARENTSYDARVDDDLGGNTETCEFWASSI
SIIQEGKLPREPVLRTAAIIRVHAYIAKSQHEALMEEKRRENFDDTREGNSSKRQTRGDK
AREAASQELPIKDTSTSLEEKTRETKDKGKSIAYKLLFDIEEATNLKGVLEEPNNTWGEL
YGACPDFKIRNGNVATWQHFFVQDTMSYPLILGQPYITAIWMETKVLDDGSTYVRAYSED
GRKDVQFLTVPPNYERNRDRLREKPLPKIVEGFKDFGEVLSRDEGAFDASFIGILENGNI
MYKKVDDFKRKERKRLYNIERELRKLDTLQDDERILGVYEENGLEDLLELITSIGLGDND
KIVEIHSREVYTILESFQAPEITVETRYKMADKKVKPVAGPLLEDSKE
Download sequence
Identical sequences A9RTC3
3218.JGI70290 XP_001757407.1.60028 jgi|Phypa1_1|70290|fgenesh1_pg.scaffold_27000119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]