SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9RZP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A9RZP7
Domain Number - Region: 269-312
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00172
Family Retrovirus zinc finger-like domains 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A9RZP7
Sequence length 316
Comment (tr|A9RZP7|A9RZP7_PHYPA) Predicted protein {ECO:0000313|EMBL:EDQ75479.1} KW=Complete proteome; Reference proteome OX=3218 OS=Physcomitrella patens subsp. patens (Moss). GN=PHYPADRAFT_72661 OC=Physcomitrella.
Sequence
MNGDYDYDNHRRNQQVKERQERFYFRNLLRQQQEGIQRKKRRWSWIKPWLHACVSIRAYP
SFERSTILHHYIPLEKLSRALVGDTASNEASESSSIIIRSLSTEELNNSDSLQERRVSKY
QIGTKRRIHINIARRPAQASMAEEAPAVPIAVQMGAIRDCTTSVVPLSTFNGWPGNQVPM
TNTMIGSYPRMIAPSMENLNSQGVVNATPLQAIPPVATYPSPMAYRQPEVPMNATINDSN
EALLLNLTKKMEELAVHMTKDKEKRHKPSNMRPNVWCNNYKGQGHFDTECPSPHQKMGQC
MYCGGKHNTANCWYLP
Download sequence
Identical sequences A9RZP7
3218.JGI72661 jgi|Phypa1_1|72661|fgenesh1_pg.scaffold_38000046 XP_001759567.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]