SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9S3K5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9S3K5
Domain Number 1 Region: 1-180
Classification Level Classification E-value
Superfamily Cyclophilin-like 2.34e-53
Family Cyclophilin (peptidylprolyl isomerase) 0.0000228
Further Details:      
 
Domain Number 2 Region: 225-337
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.49e-26
Family Canonical RBD 0.0067
Further Details:      
 
Domain Number 3 Region: 338-360
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000117
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A9S3K5
Sequence length 388
Comment (tr|A9S3K5|A9S3K5_PHYPA) Predicted protein {ECO:0000313|EMBL:EDQ74353.1} KW=Complete proteome; Reference proteome OX=3218 OS=Physcomitrella patens subsp. patens (Moss). GN=PHYPADRAFT_123572 OC=Physcomitrella.
Sequence
MAVMLVTSVGELVVDLFTDLCPLATKNFLKLCKIKYYNNCLFHSVQKDFIVQTGDPTGTG
KGGDSVYKLLYGDQARFFDDEFHPTLKHDKVGIVAMASAGENANASQFYITTRAELDYLD
EKHTVFGEVGEGLDTLMRINEAFVDDNFRPFKNIRIKHTIILDDPFDDPAGLADLIPEKS
PELKPPADEVRLEDDWVPMDETMDPEELEKSLRKKEAQSRAVVLEMIGDLPEADMKPPEN
VLFVCKLNPVTEEGDLELIFGRFGKVKSADIIRDYKTGDSLCYAFIEFETEEACEAAYFK
MDNVLIDDRRIHVDFSQSVSHLWNRYRKLGKAGGDAANGGKGCFKCGEVGHFAKECPNNG
TEQKEGPTEKPKYTIKDTGGQRGHAHKK
Download sequence
Identical sequences A9S3K5
3218.JGI123572 jgi|Phypa1_1|123572|e_gw1.45.68.1 XP_001760964.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]