SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9SJY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9SJY6
Domain Number 1 Region: 139-184
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000628
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A9SJY6
Sequence length 309
Comment (tr|A9SJY6|A9SJY6_PHYPA) Predicted protein {ECO:0000313|EMBL:EDQ68541.1} KW=Complete proteome; Reference proteome OX=3218 OS=Physcomitrella patens subsp. patens (Moss). GN=PHYPADRAFT_80431 OC=Physcomitrella.
Sequence
MFVKEVQSATIVASLERAKIWEECHYDQYLTVGATMIPSQGGYQMTNWNDASKSYPGRSD
YGTIPQGIVNAVPLQAVLPSSSQPYVPYSAYQKPIPTKELTNELISRDPNESLLLTLKKK
MDELAVNLAKDKEKRHKPTNMRPNVWCSNCKGQGHLVTECSSPPQMMVQCTFCGGKHTTA
NCWNLRKQQVGQQTMSQPTSWDVNQHMQTSQPAEDKGPVQRDSPVHRVEVVNAVLTKGQQ
KGKNPIQDLDDPIEVTTVALSKRRTEPISVLGRIPILSPQQDEESTSVSRANFSGTSRSI
PNDHIPIPA
Download sequence
Identical sequences A9SJY6
3218.JGI80431 jgi|Phypa1_1|80431|fgenesh1_pg.scaffold_86000058 XP_001766688.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]