SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9SK44 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A9SK44
Domain Number - Region: 389-484
Classification Level Classification E-value
Superfamily Acid proteases 0.00197
Family Retroviral protease (retropepsin) 0.036
Further Details:      
 
Domain Number - Region: 148-188
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0167
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A9SK44
Sequence length 624
Comment (tr|A9SK44|A9SK44_PHYPA) Predicted protein {ECO:0000313|EMBL:EDQ68414.1} KW=Complete proteome; Reference proteome OX=3218 OS=Physcomitrella patens subsp. patens (Moss). GN=PHYPADRAFT_80483 OC=Physcomitrella.
Sequence
MEVFPHALKDEYFLEDVDHVTKKLFLEWIERPNKNLQATELLREFERQYSQLSKVEKLTL
EPNKVDLFLQAADGELERKNDRSNILKTIQAPKAPVRTTPPTMPTVQPSTSLSKKADMGM
EEIIRGMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIWQ
GIICWKDGKIALKNREELLQTNFGKGGMRALVQDYLKEHETAARESTSYGARVDDEIGGS
TETSEFWASAVSTMQEGKLPREALLGTATIIRGRTGWEDPVESLSVHAYIAKSQHEALME
EKRRGNFDDTREGNSSKRQTRGDKAREAASQELPVKDTSASLEEKTKETKDKGKSIAYKL
LSDIEAATNLKGVLEERILNAKARATTEVLVKVGDIEEPIVALVDHGSEINLMSKDLYKK
PKWPIDMEHGWTIRAANNTQGELYGACPDVKIWIGDVATEQHFFVQDTMSYPLILGQPYI
TATRMETKVPEDGSAYARVCSQDGRKVVQFLTVPPNHERNRDRLREKPLPKIVEGFKDFG
KLGTLQDDERILGVYEENGLEDSLELITSIGLGDNDKIVEIHSREVYTVLESFQAPEVTV
ETRYKTVDKKVKPVAEPLPEDSKE
Download sequence
Identical sequences A9SK44
jgi|Phypa1_1|80483|fgenesh1_pg.scaffold_87000006 3218.JGI80483 XP_001766783.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]