SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9SV69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A9SV69
Domain Number - Region: 366-411
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000328
Family Retrovirus zinc finger-like domains 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A9SV69
Sequence length 1038
Comment (tr|A9SV69|A9SV69_PHYPA) Predicted protein {ECO:0000313|EMBL:EDQ64955.1} KW=Complete proteome; Reference proteome OX=3218 OS=Physcomitrella patens subsp. patens (Moss). GN=PHYPADRAFT_84415 OC=Physcomitrella.
Sequence
MVNKNKSIASRKINQLRERQGRTQGRNLCREEQERNLKRKHRQNWIKPWLQACQRIQTYQ
EPDRLLILQSYVPLEKLPRALAGNFVNIPVEILRPLTEREGGIEVFGTPLDNFPIGGTAE
TSNRGSADWHELVANKGNYIVFQTLTFSPASQPIKLFAGNNSKARTAESSVIRIRESRDY
FKTNFRGTKNSMAAGGPAVPIAVQMGTLGDRTTSVAPLPTFRGLPSADPDQHLSQFLTAS
SLERAKVWQECHYDQHLIVGATMIPSQGGYQMTNWNDASESYPGRNDYGTIPQGIVNAVP
LQAVLPSSSQSYVPYFAYQKPIPTKELTNELVSRDPNESLLLTLTKKMDELAVNLAKDKE
KRHKPTNMRSNVWCSNCKGQGHLVTECSSPPQMMVQCTFCGGKHTTANCWNLRKQQQVGQ
QTMSQPTSWDVNQMQTSQPAEDKGPAQRDSPVHRVEVVNTVLTRDQQKGKNPIQDLDDPI
EVTIVAPSKRRTEPISVLGRIPILRPQQDEEPTSVSRANFLGTSRSIPNDHVPIPAQPNI
SSYPLKEPLVVEESTKRKELLPNKFVSGEFTANHSISANTQRFIMSREKVKRASEKEEEG
RRVRSRSNMDELSLCILTNMEPMRLEICWNATRQKDFRSAQLYSFLHAADNLPSIDVELL
EEYLTNYDPEDGSSVVKGRTLGIDENTLHKALQLPIGELAVGTEESSHFNPGSYFKGGMT
LLERNQGWRTADALTPELMEWMRFVQKRLGLNRHTTYMAKRLLYATIGSFEGMVFNWAVY
VATRIHAELSYKRRSGRIATLLCSNYIQSTIVYELSQPLPKKGKTIAAPAGEPISVRERG
PMAQRDNRPVDIQHRTPEENSVKEQFLVQLSQLQQTANELIDHTNFKQQLVACKREMAEQ
RQKLLEQDRVNRATKEANSRLEHALGVKQQAWEKERERLHHGMAHQKQELSNSLNQSKLE
VEKMKQQLELNQTKMATLEEEKKTMSDQFRVKTEEMQEEINTLKEVAKKLEEELVSVRRP
QGSIEGSIGELEQKVKQQ
Download sequence
Identical sequences A9SV69
3218.JGI84415 XP_001770280.1.60028 jgi|Phypa1_1|84415|fgenesh1_pg.scaffold_123000046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]