SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9T9L8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9T9L8
Domain Number 1 Region: 190-377
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.93e-33
Family cAMP-binding domain 0.00021
Further Details:      
 
Domain Number 2 Region: 599-643
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.000000000732
Family N-terminal domain of RNase HI 0.002
Further Details:      
 
Weak hits

Sequence:  A9T9L8
Domain Number - Region: 104-186
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0022
Family Voltage-gated potassium channels 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A9T9L8
Sequence length 647
Comment (tr|A9T9L8|A9T9L8_PHYPA) Predicted protein {ECO:0000313|EMBL:EDQ59916.1} KW=Complete proteome; Reference proteome OX=3218 OS=Physcomitrella patens subsp. patens (Moss). GN=PHYPADRAFT_89882 OC=Physcomitrella.
Sequence
MGHRTCSTLEADKAESIKINSYIMSLPREISPFSSKTLNASILEDKFSSPISQSWNMKRR
AEAVEDSGIPYVCTGYKRSNRLRKQRLSSLSSQKILRSQDPFGIFAQFSEWRHVLVFSSK
IWQIAHLYHLLVLHPYLSAIIQTTPSFGNALVPSNHFFEVLFSIGVITSGLLLFTLLIGN
IQVFLQSITSKKSEMQLRNRDLEWWMRRRQLSHRLRVRVRQQECCRWAATRGIDEESIVG
NLPEGLRRDIKRHLCLDLLRKVPLFEQLDDLILNNVCDRLKPVLFIKEEPIIHEGNPLSH
MLFFVRGRILSMYRIHDKRMSNCTLGPGDFFGDELICWCLSKSTGRLPLANASLITLQVT
EAFSLSAEDLKYITDHFRYKVASKQLKRTTRYYSTSWRMWAAMAIQLAWRRFKARRSKFY
SGPLNFAPLRNESSGLDAAQQDRLRIVHSNASAALVEAPTTMSFAGCALCDGLWVPYQVA
VWTFSGLCADYTGQDCWNIDTTMTELATANARWRDMKPSHPLLAELIQPLLLALRAVLRS
AQHMLAALVQFVERRIFKDMELVEQQLLVADGEEYCPPSMPEAMSAEACRYSKPTESRRY
CAVHVGRNVGIYTSWAACEREVRGFSGTQCKRFRTKQYAEEYLMRRF
Download sequence
Identical sequences A9T9L8
XP_001775311.1.60028 3218.JGI89882 jgi|Phypa1_1|89882|fgenesh1_pg.scaffold_189000043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]