SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9TCB7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A9TCB7
Domain Number - Region: 211-233
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0254
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A9TCB7
Sequence length 239
Comment (tr|A9TCB7|A9TCB7_PHYPA) Predicted protein {ECO:0000313|EMBL:EDQ58883.1} KW=Complete proteome; Reference proteome OX=3218 OS=Physcomitrella patens subsp. patens (Moss). GN=PHYPADRAFT_90908 OC=Physcomitrella.
Sequence
MELNRVSEKKMVALFGLAMILEIRDHITSITDRYGNSWEIFSHALKDEYFLEDADRVTKK
LFLEWIERPNKNLQYSQLSKVEKLTLEPNKVHLFLQAADGESQGKLELLLEDKEEDEGLT
KKWKNVEDAVGLLTKRERRKDRSNILKTVQAPKAPVHTTPPKMPTVQPLTSLSKKVDMGM
EEIIRGMRDLQIKLARLEENTSINNSKNVSKEGYVQRCIWCDDASHTRKDCNEFNNMIR
Download sequence
Identical sequences A9TCB7
jgi|Phypa1_1|90908|fgenesh1_pg.scaffold_203000009 3218.JGI90908 XP_001776250.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]