SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9TCT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9TCT1
Domain Number 1 Region: 140-173
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000811
Family Retrovirus zinc finger-like domains 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A9TCT1
Sequence length 328
Comment (tr|A9TCT1|A9TCT1_PHYPA) Predicted protein {ECO:0000313|EMBL:EDQ58779.1} KW=Complete proteome; Reference proteome OX=3218 OS=Physcomitrella patens subsp. patens (Moss). GN=PHYPADRAFT_91080 OC=Physcomitrella.
Sequence
MFVKEAQSITVSASLDRAKVWEECHYDQFLTTSATMIPVQSNYQYPALNGSVGSYPQMIK
TVAHSSANTQGSVNVIPLQALPPQVTTAYAPYFPYQTQESTLVEKQIIPASKDSNEALLL
NLMKKMEEMAINMVKDKEKRQKPTNTRTNVWCSNCQGHDHFVTECPSPSQVLGKIEGINR
GPQDSPVNRVECVHTVLTRSQQKGKGQSHPITDPSHSGPDTGKVLSLDLVVKPNEVPITE
SSVPSGVDLLPLQFQEASYPLKDPLGKGSPKEAQAAVSIPSLILDKRTRIGFSKLDPIGS
SNPSCELALLFLLTPVIGIEQSISVCPG
Download sequence
Identical sequences A9TCT1
XP_001776395.1.60028 3218.JGI91080 jgi|Phypa1_1|91080|fgenesh1_pg.scaffold_205000040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]