SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A9TDV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9TDV8
Domain Number 1 Region: 104-142
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000335
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A9TDV8
Sequence length 183
Comment (tr|A9TDV8|A9TDV8_PHYPA) Predicted protein {ECO:0000313|EMBL:EDQ58338.1} KW=Complete proteome; Reference proteome OX=3218 OS=Physcomitrella patens subsp. patens (Moss). GN=PHYPADRAFT_91483 OC=Physcomitrella.
Sequence
MIPSQGGYQMTNWNDASESYPRRSDYGTIPQGIVNAVPLQAVLPSSSQPYVPYSAYQKPI
PTKELTNELVSRDPNESLLLTLTKKMDELAMNLAKGKEKRHKPTNMRPNVWCSNCKGQGH
LVTECSSPPQMMVQCTFCGYANKPTGGGQRSCSTRLTSTSRRGGERSAYQGPTERQESNS
GPG
Download sequence
Identical sequences A9TDV8
3218.JGI91483 jgi|Phypa1_1|91483|fgenesh1_pg.scaffold_211000015 XP_001776788.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]