SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9TI85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A9TI85
Domain Number - Region: 155-193
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0194
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A9TI85
Sequence length 679
Comment (tr|A9TI85|A9TI85_PHYPA) Predicted protein {ECO:0000313|EMBL:EDQ56858.1} KW=Complete proteome; Reference proteome OX=3218 OS=Physcomitrella patens subsp. patens (Moss). GN=PHYPADRAFT_93095 OC=Physcomitrella.
Sequence
MWSRLRGSILFQAVIFSVPSQGTLFSVNGFLKGKNGGESLTARANFGSKLEDSQWIQDHK
EEDEGLTTKWKNVEDAVGLLTKKERRKDRSNIPKTVQAPKAPVHTTPPTMPTVQPSISLS
KKADMGMEEIIRGMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDCNE
FNNMIRQGIICWKDGKIALKDREDLLQTNFGKGGMRALVQDYLKEHETVARESASYGARV
DDEIGGSTETKGNSFKRQTRGDKAREATSQELPVKDTSASLGEKTTETKDKGKSIAYKLL
SDIEAATNLKGVLEERILNAKVEFILKEVLRIAKKEFHDVIIDNIKRKRQLMGETGMSHA
IDARICRDEEEVDIGYKQPTNEKNGYNQQVGDIEEPIVALVDHGSEINLMSKDLYKKQKW
PIDMKHGWAIRAANNTRGELYGACPDVKIRIKYVATEQHFFVQDTTSYPLILGQPYITAT
RMETKVLDDGSAYARVRSEDGRKVVQFLIVPPNHERNRDRLREKPLPKIVEGFKDFGEEV
LSRDEGAFDASFIGILENGNIMYKKVHDFKRKERKRLYDIEGQLRKIGTLQDDERILGVY
EENGLEDSLELITSIGLGDNDKIVEIHSREVYTMLESFQAPEVTVETRYKTADKKVKPIA
GPLPEDSKNKWEKHQKKRV
Download sequence
Identical sequences A9TI85
3218.JGI93095 XP_001778310.1.60028 jgi|Phypa1_1|93095|fgenesh1_pg.scaffold_236000025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]