SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A9TKV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9TKV4
Domain Number 1 Region: 137-174
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000488
Family Retrovirus zinc finger-like domains 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A9TKV4
Sequence length 194
Comment (tr|A9TKV4|A9TKV4_PHYPA) Predicted protein {ECO:0000313|EMBL:EDQ55920.1} KW=Complete proteome; Reference proteome OX=3218 OS=Physcomitrella patens subsp. patens (Moss). GN=PHYPADRAFT_94079 OC=Physcomitrella.
Sequence
MFIKEARPATVDASLVRAKVWEEYHYDQFLTVGATMIPSLESQQIQPRNVSMDNYLQMAA
SNVKNVILQQPINNTPLQAIAPIMMTPYFTSPTYQKLELFTIAIVKDPNEALLLNLTKKM
EELAVNLAKDKEKRHKPSNTRPNVWCNNYKGQGHIDTECPSPRQTGVQCIFCGGKHLPKT
AGIYKGNNNLIIRP
Download sequence
Identical sequences A9TKV4
3218.JGI94079 jgi|Phypa1_1|94079|fgenesh1_pg.scaffold_254000010 XP_001779232.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]