SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9TNB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9TNB3
Domain Number 1 Region: 198-287
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.21e-29
Family Canonical RBD 0.00011
Further Details:      
 
Weak hits

Sequence:  A9TNB3
Domain Number - Region: 128-147
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0101
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A9TNB3
Sequence length 288
Comment (tr|A9TNB3|A9TNB3_PHYPA) Eukaryotic translation initiation factor 3 subunit 4 {ECO:0000256|HAMAP-Rule:MF_03006} KW=Complete proteome; Reference proteome OX=3218 OS=Physcomitrella patens subsp. patens (Moss). GN=PHYPA_020058 OC=Physcomitrella.
Sequence
MGGRRNLRWGDAAEEDDEIEGVLPPTQVFGPDEKGVKIIIEWKKNDDNVRTKVIKTIRVK
KQMKKLNPATIRRRSLGKFGDALGQNASDNLTVVSTEEIFLERTRPAGAKAEPEKGADLA
SLGNASLIVCRTCGKKGDHWTSKCPFKELAASRGIIAGGEKPPTDDNVPGISAGAGGKGS
YVPPSMRYGKGNEGESMKRPGRDDNSIRVTNLSEDTREQDLQELFSPFGSISRIYVAFDR
ETGLSRGFAFINFVNRDDAIRAINKLDGYGYDNLILRVEWATPRADRS
Download sequence
Identical sequences A9TNB3
jgi|Phypa1_1|196691|estExt_gwp_gw1.C_2710054 XP_001780104.1.60028 PP1S271_56V6.1 3218.JGI196691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]