SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9U231 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A9U231
Domain Number - Region: 384-419
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00016
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A9U231
Sequence length 551
Comment (tr|A9U231|A9U231_PHYPA) Predicted protein {ECO:0000313|EMBL:EDQ50267.1} KW=Complete proteome; Reference proteome OX=3218 OS=Physcomitrella patens subsp. patens (Moss). GN=PHYPADRAFT_100576 OC=Physcomitrella.
Sequence
MWSRLRGSILFQAILFSVPFQGTLFSVNGFLKSKNEGESLTARANFGSKLESFGTTEAIA
AEVSVVMDSQWIQDRKYKGVLKINSLGCSGFSVTSRDLPAGAKKGLRQAVEGHHQTPGAF
SSRKARNTTPLEKLPRALARNFVNIPVEILRPLTEREGGIEVFGTPLGNFLIGGTAETSN
RGSADWHDLVANKGNYIVFQNPTFSPASQQIKLFAGNNSKAMTAESSVIRIRESRDYFKI
NFRGTENSMAAGGPAVPIAVQMGTLGDRMTSVAPLPTFRGLPGGYQMTNWNDASESYPGR
SDYGTIPQGIVNVVPLQAVLPSSSQPYVPYSAYQKPIPMKELTNELVSRDPNESLVLTLT
KKMDELAVNLAKDKEKRHKSINMRPNVWCSNCKGQGHLVTECSSPPQMMVHCTFCGDKHT
TANFWNLKKQQQVKQQTMSQPTSWDVNQMQTSQPAEDKGPIQRDSPVHRVEVVNAVLISG
QQKDKNTIQDLDDPIEVTTVAPSKRRTEPISILGRIPILSPQQDEEPTSVSRANFSGTSR
SIPNDHVPIPA
Download sequence
Identical sequences A9U231
XP_001784920.1.60028 jgi|Phypa1_1|100576|fgenesh1_pg.scaffold_430000005 3218.JGI100576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]