SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9U2D3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A9U2D3
Domain Number - Region: 340-383
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000319
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A9U2D3
Sequence length 394
Comment (tr|A9U2D3|A9U2D3_PHYPA) Predicted protein {ECO:0000313|EMBL:EDQ50166.1} KW=Complete proteome; Reference proteome OX=3218 OS=Physcomitrella patens subsp. patens (Moss). GN=PHYPADRAFT_100682 OC=Physcomitrella.
Sequence
METKVLDDGSACARVRSEDGRKAVQFLTVPPNHERIQDRLREKPFPKIVEGFKDFEESYV
PLEKLPRTLAGNFVNIPVEILRPLTEREGGIEVFGTPLGNFPVGGTAETSNRGSANWHEL
VAKKGNYIIFQNLTFSPASQPIKLFAENNSKARTAESSIIRVRKNRDYFKTNFRRTENSM
AAGGPAVPIAVQMGTLGDRTTSMALLPTFCGLPASLERAKVWEECHYDQYLTVGATMIPL
QGGYQMTNSNDASESYPKRSDYGTIPQGIVNAVPLQAVLPSSSQPYVPYFAYQKPIPTKE
LTNELISRDPNESLLLILTKKMDQLAVNLAKDKEKRHKPTNMRPNVWCSNCKGQGHLITE
CSSPPQMMVPCTFCRGKDTIANCWNLRKQQQVGQ
Download sequence
Identical sequences A9U2D3
XP_001785016.1.60028 jgi|Phypa1_1|100682|fgenesh1_pg.scaffold_435000006 3218.JGI100682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]