SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9U5N0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A9U5N0
Domain Number - Region: 72-97
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00837
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A9U5N0
Sequence length 183
Comment (tr|A9U5N0|A9U5N0_PHYPA) Predicted protein {ECO:0000313|EMBL:EDQ49023.1} KW=Complete proteome; Reference proteome OX=3218 OS=Physcomitrella patens subsp. patens (Moss). GN=PHYPADRAFT_102749 OC=Physcomitrella.
Sequence
MRKDRSNILKTVQASKAPVRTTPPTMPTVQPSTSLSKKAEMRMEEIIREMRDLQIKLARL
EENTSTNNLKNVSKQGYVQRCIWCDDTSHTRKDCNEFNNMIRKDLLQTNFGKEGMRALVQ
DYLKEYETTARESTSYGVRVDDDLGGRTETSEFWASAVSTMQEGKLPREALLRTAATIRG
ATS
Download sequence
Identical sequences A9U5N0
XP_001786165.1.60028 jgi|Phypa1_1|102749|fgenesh1_pg.scaffold_744000001 3218.JGI102749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]