SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9U664 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9U664
Domain Number 1 Region: 105-142
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000178
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A9U664
Sequence length 183
Comment (tr|A9U664|A9U664_PHYPA) Predicted protein {ECO:0000313|EMBL:EDQ48839.1} KW=Complete proteome; Reference proteome OX=3218 OS=Physcomitrella patens subsp. patens (Moss). GN=PHYPADRAFT_103032 OC=Physcomitrella.
Sequence
MIPWQGGYQMTNWNDASESYPGRSDYGTIPQGIVNAVPLQAVLPSSSQPYVPYSAYQKLI
PTKELTNELVSRDPNESLLLTLTKKMDELVVNLAKDKEKRHKPTNMQPNVWCSNCKGQGH
LVTECSSPPQMMVQCTFCGDPNKPTGGGQRSCSTGLTSTSRRGGERSTYQGPTERQESNS
GPG
Download sequence
Identical sequences A9U664
XP_001786349.1.60028 jgi|Phypa1_1|103032|fgenesh1_pg.scaffold_1083000001 3218.JGI103032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]