SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9VL41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9VL41
Domain Number 1 Region: 35-274
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.11e-25
Family RNase Z-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A9VL41
Sequence length 283
Comment (tr|A9VL41|A9VL41_BACWK) Beta-lactamase domain protein {ECO:0000313|EMBL:ABY44142.1} KW=Complete proteome OX=315730 OS=Bacillus weihenstephanensis (strain KBAB4). GN=BcerKBAB4_2956 OC=Bacillus cereus group.
Sequence
MKIKSLKLYDTGYCTHPEKIAYSKGSWKQISFPATVGLLQHPVLGYILFDTGYAGHFKEA
TKKFPYSVYAKLTPVHFTEEQSIKQQLLLDGIQPEEIKYIILSHFHGDHTAGLPDFPKAK
ILTFAKAYEDIKKRSKFGALLKGCLKDTLPMDLEERMSFIDQTSSLNLPSTYGKFEEGYD
VFDDGSLFAVDLTGHATGQFGLFVHLQSNKIVFLCADAVWLSKTYQNLVFPSKIANLLTS
DPKSYRKNIEKLHHLSQTSPEIEIVPTHCEHTWDKIKVGVYYE
Download sequence
Identical sequences A9VL41 J8P4B8 J8PMR2
gi|163940886|ref|YP_001645770.1| WP_002190122.1.46157 WP_002190122.1.47674 WP_002190122.1.99908 315730.BcerKBAB4_2956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]