SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9VMT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9VMT1
Domain Number 1 Region: 1-113
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000000000952
Family DNA-binding N-terminal domain of transcription activators 0.013
Further Details:      
 
Weak hits

Sequence:  A9VMT1
Domain Number - Region: 257-390
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.0272
Family Plant O-methyltransferase, C-terminal domain 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A9VMT1
Sequence length 410
Comment (tr|A9VMT1|A9VMT1_BACWK) Transcriptional regulator, MerR family {ECO:0000313|EMBL:ABY44354.1} KW=Complete proteome OX=315730 OS=Bacillus weihenstephanensis (strain KBAB4). GN=BcerKBAB4_3178 OC=Bacillus cereus group.
Sequence
MKIGTFAKLFHVTTDTVRYYIELGLLIPDKKNTQYQMNQLCFDDMTFITELKKFHFSLIE
IQRILSYRRVTNFSDHEDIDYYNNSLIDKKDELTKKKEDISKAIQLIEKAVQTSSPSSKE
ESITGIPLDFVNFLYCPKCRIPLEMKDVTIKKVYIHTGSLTCSCGYEAAIEEGIIITANL
YETSPYPSYFYDKETIKEINPKMINLFEKSNFRFQKVLQNIDLKNKLIVETNVDAFVSLP
KYIDVLEPSANYVFSGYSLAMLKKVRNRIERMNPKPRVLYILNSDLNLPLKPLSIDVFVD
SFTITDFSLLNPEFPSHVLKNYLHNSSTIVGGYSYYDNSAKSLKNISALYPNSHEHILHP
KYLEENLSVNGFQIMQNENIGYCTDPGPYFDYHVRDEKFHMLMYLANTKQ
Download sequence
Identical sequences A0A1S9T587 A9VMT1 J7ZHI5
gi|163941098|ref|YP_001645982.1| 315730.BcerKBAB4_3178 WP_002142594.1.85012 WP_002142594.1.86789 WP_002142594.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]