SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9VPY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9VPY8
Domain Number 1 Region: 90-235,364-529
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000000383
Family Galacturonase 0.056
Further Details:      
 
Weak hits

Sequence:  A9VPY8
Domain Number - Region: 563-750
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00102
Family Pectate lyase-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A9VPY8
Sequence length 776
Comment (tr|A9VPY8|A9VPY8_BACWK) Uncharacterized protein {ECO:0000313|EMBL:ABY44564.1} KW=Complete proteome OX=315730 OS=Bacillus weihenstephanensis (strain KBAB4). GN=BcerKBAB4_3390 OC=Bacillus cereus group.
Sequence
MAKFQVTCVLKSNLPVLSEGEFCFCIDTSELFIGTKKGNVKVSTENTFERLVSKLKSNTF
GGFKSRKSLVGETESANVVSGTYFLELERWNVKNDGTDADNTSKGINNALLWASQQGFIE
VVLPLGTYLIDENTPIEPQSFMTLNLGGSTLKIRSNGLVKYAIVRYQRNQKFSRVTNGRI
EGDKNTHDYTTIPHTHEWGYGIEVGNTTPAEGSNMNYISIDNMEILNCTGDGIAMESTWG
QIGEYDFAGTFEVGGISDVNGALIVDDNKIRSNLKIDLHHSSIIKWGYFGLYGDGYGGTG
SEIYTELYDVLFYRADNTFVTAAKRVKFFEEVSVPEEADYAKIVLHQGTVPTENGCKITV
RIPEFSKNVFIEKCKIHDCRRLGVSVSGAKQIYIRDCEIYKMKGTAPQGAIDIEDGYRLN
QYINIERNNIYDNQGYNVVVVGGRYINIIQNKLANNSLVVGENVEKVIISNNHLREVSCV
LSGEVTFTNNQMYATRVTIDQGDKEALIGNCTFHNSALLMGRDKAYCIQVNQCEFFSDRD
LFHTFSQLGAIIGFSAEPQTISDCVIKGGAVEGTSLTGVSPGMKNGWRLNNISFIDTKHP
QGIIMNLPPGVYTGCKFENSGTISFVTNTPQAEYEFNGCSFSWDAYNLFTVESSQRIAML
KVKNSNFRGGRWGSAFFLWDIGGRIEFNNNAFEYLNSESTDSIINFWNETFTSEFMLIEN
NIFRSNKSMIGLNAIQISSSITLIFKDNIVDTVVIKLRDEHIKKDNYINGVFDPYV
Download sequence
Identical sequences A0A1C4EMW5 A9VPY8 J9C8S6
315730.BcerKBAB4_3390 WP_002137802.1.50411 WP_002137802.1.59016 WP_002137802.1.73166 WP_002137802.1.99908 gi|163941308|ref|YP_001646192.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]