SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9VQY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9VQY9
Domain Number 1 Region: 1-64
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 4.02e-18
Family Phage repressors 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A9VQY9
Sequence length 142
Comment (tr|A9VQY9|A9VQY9_BACWK) Transcriptional regulator, XRE family {ECO:0000313|EMBL:ABY44638.1} KW=Complete proteome OX=315730 OS=Bacillus weihenstephanensis (strain KBAB4). GN=BcerKBAB4_3465 OC=Bacillus cereus group.
Sequence
MIGLRIKSLRKKENLTQKQLAEKIGVSQRMIGYYESEERFPPHDVLSKLADCFSVSADYL
LGRAVTDQPKEQLTQKDGKDIAKRMEEIKRDLQGEDGLMFSGEPMSEEAVESLLDAMEYI
VKQTKVINKKYVPKKYRSTDDN
Download sequence
Identical sequences A9VQY9
gi|163941382|ref|YP_001646266.1| WP_012261509.1.69703 WP_012261509.1.99908 315730.BcerKBAB4_3465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]