SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9VTZ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9VTZ4
Domain Number 1 Region: 22-104
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0000000000301
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.004
Further Details:      
 
Domain Number 2 Region: 106-169
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.00000000134
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0032
Further Details:      
 
Domain Number 3 Region: 171-277
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.00000000353
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A9VTZ4
Sequence length 297
Comment (tr|A9VTZ4|A9VTZ4_BACWK) MscS Mechanosensitive ion channel {ECO:0000313|EMBL:ABY43310.1} KW=Complete proteome OX=315730 OS=Bacillus weihenstephanensis (strain KBAB4). GN=BcerKBAB4_2085 OC=Bacillus cereus group.
Sequence
MSLLTYTEEFFNYVREFLLLRFLLFALVLIIISFVINRSIDWFFKKSSFFDEEVEQTIQS
VIRSIFRYIIIISLIIYLISQFVDIKSIIAGAGIAGVVIGFAAQQMLKDVILGFARLADK
EFRVGDFVTFNGTNSGTIEEISVRFMQIREWSGKLLTIPHGEIRTIQNFNKGWMRVIERI
TVSYQEDPTRVKELLEEVCVICNEKLDQSLYRVDDEAVEPFKYVGVTDLNPNLKYVGYEF
CITGLIKPEDYFETSRQVRFELMSIFHKNQVQMPAANMFVNTESLQNIHVGQSLSDS
Download sequence
Identical sequences A9VTZ4
WP_012260878.1.99908 315730.BcerKBAB4_2085 gi|163940054|ref|YP_001644938.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]