SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9VVH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9VVH5
Domain Number 1 Region: 34-103
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000104
Family NE1354 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A9VVH5
Sequence length 128
Comment (tr|A9VVH5|A9VVH5_BACWK) Transcriptional regulator, XRE family {ECO:0000313|EMBL:ABY46790.1} KW=Complete proteome OX=315730 OS=Bacillus weihenstephanensis (strain KBAB4). GN=BcerKBAB4_5295 OC=Bacillus cereus group.
Sequence
MNNKDYVNFDRVTQESDVWQKRKYKGYAPLHRTKTPTGIRIVLGDYLKKIDMSQRSLAEL
CGLTQPMVNDMCENRTTFLNISHLVRITSVLGITVDDIIQITPIQETAYTESDSIHSVIN
GKRSGATR
Download sequence
Identical sequences A9VVH5
WP_012260027.1.99908 315730.BcerKBAB4_5295 gi|163937879|ref|YP_001642765.1|NC_010182 gi|163937879|ref|YP_001642765.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]