SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9VXC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9VXC8
Domain Number 1 Region: 400-493
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000106
Family Anti-sigma factor antagonist SpoIIaa 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A9VXC8
Sequence length 501
Comment (tr|A9VXC8|A9VXC8_METEP) Sulphate transporter {ECO:0000313|EMBL:ABY32021.1} KW=Complete proteome OX=419610 OS=Methylobacterium extorquens (strain PA1). GN=Mext_3643 OC=Methylobacteriaceae; Methylobacterium.
Sequence
MSSTVSTARGRFGSTWFANWFANPWADILSGIVVALALIPEAIGFSVIAGVDPKVGLYAS
VVIACVIAFAGGRPAMISAATAATAVVMVDLVRDHGVQYLFAATILMGVFQILAGLARLG
RLMRFVSRSVMTGFVNALAILIFLAQLPELTGVTPATYGLIALGLAIIYGFPKLTRAVPS
PLVAIAVLTALTAYLGLDVRTVAHLGALPTTLPSFALPDVPLTFETLRIILPYSATLAAV
GLLESLLTAQIVDDMTDTGSSKNRECMGQGLANMSSAVFGGMGGCAMIGQSVINVSSGAR
GRLSTLVAGSFLLALLVLLQDLLAIVPVAALTAVMIMVSLNTFSWRSLLALRTNPLPSSL
VMLATVAVVVATRDLAIGVLVGVLLSGVFFAGKVARMSRITAELSLDGRTRTYRVAGQVF
FASAGSFAEAIDVREPVERLVIDVHAAHFWDISAVGALDRVVMKARAAGRTVEVVGLNEA
SATLVERFGQHDKADASLPAH
Download sequence
Identical sequences A9VXC8
gi|163853049|ref|YP_001641092.1| 419610.Mext_3643 WP_012254861.1.40058 WP_012254861.1.62458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]