SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9WI88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9WI88
Domain Number 1 Region: 261-370
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.26e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0043
Further Details:      
 
Domain Number 2 Region: 101-229
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000011
Family Heme-binding PAS domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A9WI88
Sequence length 375
Comment (tr|A9WI88|A9WI88_CHLAA) Sulfate transporter/antisigma-factor antagonist STAS {ECO:0000313|EMBL:ABY36380.1} KW=Complete proteome; Reference proteome OX=324602 OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl). GN=Caur_3185 OC=Chloroflexaceae; Chloroflexus.
Sequence
MLDTLPLPTAYAPDGGSVQCNRLWLELSDGGGVARDLVEACAQILAWNESEVAAARQWIA
TLSAGDPPLQLAAPLRRDPTRHVQIMILRSEAALTAQVVEVTALLTAQRAAQHQLDVILS
ALDSLEEGFLLLDKDDRIVFCNRRYRELYAISADLVTPGRPFAEMIRIGAERGQYAEAIG
RVDEWVAERLRKHAALEPVEQHLADGRWIRIVERRTADGGIVGLRIDITELKKAEELRRQ
LAVREEVIATQAALLAELSTPLLEVATRVLLAPMVGAFDSARVATLIESLLQAVQRRQVR
IVVLDVTGVPVIDTQVAHAILQCATSLRLLGAQLVITGIRPDVAQTLVALGVDLSTIVTR
ADLRDGVQYALRQSR
Download sequence
Identical sequences A9WI88
gi|222526669|ref|YP_002571140.1| WP_012259033.1.35445 YP_001636769.1.55443 324602.Caur_3185 480224.Chy400_3438 gi|163848725|ref|YP_001636769.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]