SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9WSG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9WSG6
Domain Number 1 Region: 87-145
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000196
Family NfeD domain-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A9WSG6
Sequence length 166
Comment (tr|A9WSG6|A9WSG6_RENSM) Membrane protein implicated in regulation of membrane protease activity {ECO:0000313|EMBL:ABY23754.1} KW=Complete proteome; Reference proteome OX=288705 OS=/ NBRC 15589 / NCIMB 2235). GN=RSal33209_2021 OC=Renibacterium.
Sequence
MFEWLFENGWALWLIIFLALAVIEMLTLDLFFILMSVGALAAVVADLLGAPLWLQVIIFC
IVALAMILFVRPIALRHLHKGPNDLRTNVDRLIGHAAVVIEPVTSDGGRVKIGGDIWSAR
STNGAALAIGNNVEVTAIEGATAIVVAAAITPQSPHAEYPGTPAGA
Download sequence
Identical sequences A9WSG6
288705.RSal33209_2021 gi|163840763|ref|YP_001625168.1| WP_012245424.1.55099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]