SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B0C3R0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0C3R0
Domain Number 1 Region: 478-689
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 2.28e-38
Family Protein prenylyltransferase 0.01
Further Details:      
 
Domain Number 2 Region: 171-371
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.66e-29
Family Prokaryotic proteases 0.0056
Further Details:      
 
Domain Number 3 Region: 394-510
Classification Level Classification E-value
Superfamily TPR-like 2.61e-20
Family Tetratricopeptide repeat (TPR) 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B0C3R0
Sequence length 712
Comment (tr|B0C3R0|B0C3R0_ACAM1) TPR domain protein {ECO:0000313|EMBL:ABW30997.1} KW=Complete proteome; Reference proteome OX=329726 OS=Acaryochloris marina (strain MBIC 11017). GN=AM1_6065 OC=Acaryochloris.
Sequence
MSLDFYGDVQKQKRVMKQHRGVMWGLLLFNLGLLGLPVLLAPTSSQAQTVTKNCDGQRPV
GDHRTSATPLPAGLSPFPGTNPPEPQPATVRIGHNVSIGYGVRVEGQVVTKKPGLPLQGP
GSPAVPVPEGVSTGPIAALYPDTCKTKAQPIALPQTDRPTGTSPVALATGNIAQRAKQVT
VRLGNDITEGSGVIIERQGNTYTLLTAAHVVAATDSPYRITTDDQQQHTALQVRPLKDID
LAVVTFQSDRAYSVCSLANGQTASEGLPVFVAGFPMTTAAITQPVYNFTDGKITARSSRS
FADGYAMIYSNRTLPGMSGGGVFNRNGELIGIHGRGDVDSALEASTINTDIRIKTGFNLG
IPIESFLKQAKSLGMTFKAHLPANAPPPSPVDDALINAAIKAQSGDYAGARAVLSQAIGT
SPREARLYLARANYAIASGQTQAALQDLDRVIEFDPKAEQAYWLRGAYRNASRDAAGAIS
DFSRVIELNPNRLQAYLWRATLYMAQTDYQSAIQDYSAIIRLDPKNVLAFSQRGSTRFIQ
GDQQGALKDYDQLIKLNPKNVEAYDRRAHVRRYSGNPQGALQDYRMITKINPRNSRAYEQ
IASLSEDQNDLEGAIAAYGQLQTLKPNDTSVYMSRGQLYEKQKRYVEAIADYTKMIELQP
FQTSWFIMRGSAREKAGQRAGAKADYRQVAKLYQQQGDSSSAKDWLERANKL
Download sequence
Identical sequences B0C3R0
gi|158339139|ref|YP_001520316.1| 329726.AM1_6065 WP_012166194.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]