SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B0C6J8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0C6J8
Domain Number 1 Region: 16-272
Classification Level Classification E-value
Superfamily HemD-like 3.66e-44
Family HemD-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B0C6J8
Sequence length 287
Comment (tr|B0C6J8|B0C6J8_ACAM1) Uroporphyrinogen-III synthase {ECO:0000313|EMBL:ABW26419.1} KW=Complete proteome; Reference proteome OX=329726 OS=Acaryochloris marina (strain MBIC 11017). GN=AM1_1388 OC=Acaryochloris.
Sequence
MTDLLLSTARLPLGNKRIVITAPRPYAGRLATAIIQQGGLPIVMPTIETYALDPAPDLDH
ALQQLRDFSWVAFTSRTGIQAVMLRLQQLDIPLFLLNQCHICAIGQDADQLQTLGVRVDL
IPKESSPAGLVAELAQIPDIDTRRIFVPIPQVERIPEPDIVPKFLADLEQLGLTVVSVPA
YVTRRLEATAYAVEVEQIRQGKVDAIAFSSTAEISALLQMVDAETLMKHCVIACFGPYTA
GNAKDLGLSVDIVSQDFSSFTGFTAAIAQFFHPASADIPRQDPVILP
Download sequence
Identical sequences B0C6J8
WP_012161951.1.67183 gi|158334561|ref|YP_001515733.1| 329726.AM1_1388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]