SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B0C7K9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0C7K9
Domain Number 1 Region: 3-104
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.12e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B0C7K9
Sequence length 124
Comment (tr|B0C7K9|B0C7K9_ACAM1) STAS domain protein {ECO:0000313|EMBL:ABW25269.1} KW=Complete proteome; Reference proteome OX=329726 OS=Acaryochloris marina (strain MBIC 11017). GN=AM1_0183 OC=Acaryochloris.
Sequence
MQQLPSFCIVHPPQHLTSTTQDVFYQHIYELVQSRVEVILINLETVTRLDSGGLGILFGA
FRISHRQGKRLMLYSPQSHVVQNLHKTGLTQIVGTYATLADCIKDAIPYSHRWVQDLSIQ
LPEF
Download sequence
Identical sequences B0C7K9
gi|158333411|ref|YP_001514583.1| 329726.AM1_0183 WP_012160881.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]