SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B0CCC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0CCC0
Domain Number 1 Region: 3-118
Classification Level Classification E-value
Superfamily RbcX-like 4.84e-43
Family RbcX-like 0.0000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B0CCC0
Sequence length 133
Comment (tr|B0CCC0|B0CCC0_ACAM1) RbcX chaperonin protein {ECO:0000313|EMBL:ABW26805.1} KW=Complete proteome; Reference proteome OX=329726 OS=Acaryochloris marina (strain MBIC 11017). GN=AM1_1784 OC=Acaryochloris.
Sequence
MDQKRVAKDTAQVLISYLTYQAAKLVVTQLYETNPGLGIWLSEFSSTDRIQDGEFYLEAL
MQENRELALRLLTVREHLAEEVVEFLPEMVKTGIQESNVGHRRQLLERMTQMSTPESTSN
GDELEADADEELD
Download sequence
Identical sequences B0CCC0
WP_012162316.1.67183 gi|158334947|ref|YP_001516119.1| 329726.AM1_1784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]