SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B0CET9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0CET9
Domain Number 1 Region: 30-223
Classification Level Classification E-value
Superfamily Formyltransferase 3.66e-61
Family Formyltransferase 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B0CET9
Sequence length 223
Comment (tr|B0CET9|B0CET9_ACAM1) GAR transformylase {ECO:0000256|HAMAP-Rule:MF_01930} KW=Complete proteome; Reference proteome OX=329726 OS=Acaryochloris marina (strain MBIC 11017). GN=AM1_4357 OC=Acaryochloris.
Sequence
MSFSASESVSPALVSPDEISLEKLSSSPPLKLGIMASGTGSNFVAIADAIAQHHLAAHIQ
VVIYNNPDAPVAQRAQERQIPTHLINHRHFSTREVFDQQIVDRLREADVDWVVMVGWMRR
VTQVLIDAFPDRMINIHPSLLPSFPGIRAIEQALEHQVKISGCTVHIVRLEVDSGPILIQ
AAVPVYPEDTPASLHRRIQIQEHRIIVQAIAQLIQNRLTPCRQ
Download sequence
Identical sequences B0CET9
WP_012164662.1.67183 329726.AM1_4357 gi|158337478|ref|YP_001518653.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]