SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B0CQT5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B0CQT5
Domain Number - Region: 388-416
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0115
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B0CQT5
Sequence length 489
Comment (tr|B0CQT5|B0CQT5_LACBS) Microfibrillar-associated protein MFAP1, Zn finger, CCHC type protein {ECO:0000313|EMBL:EDR15694.1} KW=Complete proteome; Reference proteome OX=486041 OS=deceiver) (Laccaria laccata var. bicolor). GN=LACBIDRAFT_399370 OC=Laccaria.
Sequence
MSSIRKDAPRLPRPAARYWKGKAPKGAAEAGSDSEDEATATPLEEGDVPIQDHQDASEDE
EEEDGIQLRRDVAKSKSISVALKDVSVSKEGRVIIAGREESGRTVVEAEGMTYHYLFLLF
CRTREAILKLICKESEEEESDEEQTKPGKKSAEGSAEESSEYESDSEEEEKPKLQFRPVF
VPKRARITISEKEAIAQDTQEALAKKEAEAEERRKQSHDLVAESIRRELAEKEKDEEIPD
VDDTDGLDPAAEFEAWRLRELNRIKTEKEEELRREEEREEIERRRAMPEEQRMKEDLERA
QKLREDKPKGQQKFLQKYWHKGAFHQDEEILKRHDFTEATESTIDVSMLPKVMQVKNFGK
RSRTKYTHLLDQDTTAPSGGFGGTAPVRAGGTSLDGGGCFLCGGPHLKKDCPQNTGPLSE
RGSGANAGPIGSRQFGGRRDQGSWRDDDGDERIAARKDYRRGNDRAEDDVDNYHRSRSPN
GREKRRRVG
Download sequence
Identical sequences B0CQT5
jgi|Lacbi1|300887|eu2.Lbscf0001g03360 XP_001873902.1.58555 29883.JGI300887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]