SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0CVM7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B0CVM7
Domain Number - Region: 6-42
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000126
Family Retrovirus zinc finger-like domains 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B0CVM7
Sequence length 179
Comment (tr|B0CVM7|B0CVM7_LACBS) Predicted protein {ECO:0000313|EMBL:EDR13771.1} KW=Complete proteome; Reference proteome OX=486041 OS=deceiver) (Laccaria laccata var. bicolor). GN=LACBIDRAFT_309136 OC=Laccaria.
Sequence
MSKYAPHRRSTNQPRATSSTICQKCLGRGHFIYECKESRPYVSRPSRTQQLENPRLLAKL
KADGKPSVQVPEEFKKKTGTANMILEAKEKERSKDEKGKEKERPRKKAKRSSSSSGSDSD
SDSGSSNSDSSSSRSSGSDSGSSSGSSSGSSRSRKRSRKRRVARRGPSPSSRDGHSDDD
Download sequence
Identical sequences B0CVM7
XP_001876269.1.58555 29883.JGI309136 jgi|Lacbi1|309136|eu2.Lbscf0003g07750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]