SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B0CX82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0CX82
Domain Number 1 Region: 30-241
Classification Level Classification E-value
Superfamily Ribosomal protein L1 9.03e-40
Family Ribosomal protein L1 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B0CX82
Sequence length 321
Comment (tr|B0CX82|B0CX82_LACBS) Predicted protein {ECO:0000313|EMBL:EDR13627.1} KW=Complete proteome; Reference proteome OX=486041 OS=deceiver) (Laccaria laccata var. bicolor). GN=LACBIDRAFT_230477 OC=Laccaria.
Sequence
MAKDELIDSKVSLKQCRLAVEALHSHESKRLEKLQETELLPGKEQNIWLNVTVKKIPSGH
KFKPIKIPIIHPLVDPRTTPVCLITKDPQRQYKDLLESHEIKFISRVVGVEKLKGKFKPF
EARRALLKENGLFLADERVIPLLPKLLGTKWFEAKKQPIPVCLTRKDLKGELERAISSTY
MNQNQGTCTSIKVSSLSHKPAQVLANIQSAIPAVVKHIKGGWDNVQSFNIKTNSSVSLPI
WSCRLDGEEGGRWDGFAAEDEQSDDEDKEKDSGEEEEMEVDDDSTKTKKGAKKSGLKRAT
SSDEEEEEEKPRKKSKGVKGT
Download sequence
Identical sequences B0CX82
29883.JGI230477 jgi|Lacbi1|230477|e_gwh1.3.611.1 XP_001876125.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]